The Word Database
Data for millions of words, phrases, rhymes, crosswords and more!
Find rhymes, synonyms, antonyms, meanings, sentences and more for over 350,000 words, all categorized for easy navigation. Find words with similar endings, similar beginnings or words that contain a series of letters to help with word games such as Scrabble, Words With Friends, Wordfeud, Wordle, crosswords and more.
Database Statistics:
- Rhymes: 100m+
- Synonyms: 5m+
- Antonyms: 3m+
- Definitions: 500k+
- Sentences: 5m+
- Idioms: 8k+
- Anagrams: 10m+
- Crossword Clues: 6m+
Word Tools
Words By Length
Trending Words
Popular Words Trending For May 18, 2024
proberazorpoliticallystatedautopsynineteencommittingbuzzvileyayprovedauctionswisssuspendedtammystitchwakingdaylightmeaningfulbackingwosplashesteemprovidedcombinedexaggeratingdevotedbonusgallerysophisticatedcropinsightexquisitebribeheapmourningexplosiverestrictedkiloresignedbeckbakeyachtpurchasespitefinchignitionstrugglingnumerousstations
Latest Crossword Clues
New York Times (NYT) - May 19, 2024
- Across 1: End of the line?
- Across 5: Agnus ___ (motif in Christian iconography)
- Across 8: French companions
- Across 12: Hubris
- Across 17: Lead-in to marine or marathon
- Across 19: The house, to a blackjack player
- Across 21: 1993 Beck single
- Across 22: Break up the band, say
- Across 24: Charades, but not chess
- Across 25: Certain wedding role
- Across 26: "If that missing house title ever does show up …"
- Across 29: Grunting ox, by another name
- Across 30: Poetic preposition
- Across 31: Show with the Church Lady and Target Lady, for short
- Across 32: Bill in a till
- Across 33: Change for a 32-Across, perhaps
- Across 37: Having a studious appearance
- Across 40: Treats that Paul Hollywood and Prue Leith picked as runner-up to Doritos for "best snack in America"
- Across 42: Tiniest amount
- Across 43: Question from someone with a lot of outstanding debt?
- View all...
New York Times Mini - May 19, 2024
- Across 1: With 4-Down, popular mint brand ... and a hint to this puzzle's "three-in-a-row"
- Across 4: Scroll in a synagogue
- Across 6: Love to bits
- Across 7: "Official," as a body of fiction
- Across 8: French fashion monogram since 1962
- Down 1: "___ you are you! That is truer than true! There is no one alive who is you-er than you!": Dr. Seuss
- Down 2: De-wrinkling appliances
- Down 3: Song sung in December
- Down 4: See 1-Across
- Down 5: Female bird
- View all...
Find the crossword answers to all our publications such as Eugene Sheffer, Telegraph, Guardian, NYT and more!